PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G023100.1
Common NameB456_004G023100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 412aa    MW: 46482.1 Da    PI: 6.9324
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G023100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.91.5e-30205259155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rW peLHe F++av+qLGG++ AtPk+il+lm+v+gL+++hvkSHLQkYRl
  Gorai.004G023100.1 205 KQRIRWIPELHELFLNAVDQLGGPDCATPKNILKLMNVEGLSIYHVKSHLQKYRL 259
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.63202262IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-27203260IPR009057Homeodomain-like
SuperFamilySSF466893.05E-16203260IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-24205260IPR006447Myb domain, plants
PfamPF002498.6E-8209258IPR001005SANT/Myb domain
PfamPF143791.8E-12299342IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MQTSYPGPFS VHKFLNSDPI ALYSAYENSP SPYFMLQHQQ EEALAPISQP AMSQPHPYRF  60
NTSLNQSWLP NSKTGNHDGN RRYNQKVAVC DPSLCGEKDD FMAFTHVPAS SPCGSPQGSM  120
YAKQSLTLKE KLQLQYLTKE LEIDVSESSP LGLDQEIHEE TPQVSSDQGI HQLGFKRNHV  180
TSIVNMDGYI HSMNQQHTDA MAAHKQRIRW IPELHELFLN AVDQLGGPDC ATPKNILKLM  240
NVEGLSIYHV KSHLQKYRLA KGVSELKNDK GSSRFEEKRA TLIESDDHQS DGNIEREVDV  300
VETLQMQIEV QKLLHEQLKV QKELQLQIQQ QGQLLKKLMD ERRRKSGSAD KKMFPSENPF  360
LFSAETASFF QKSGSAKSIT DCSSSTHSPK HKASETTESE QCQKRHRGES S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473046.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A0D2MSG00.0A0A0D2MSG0_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2122345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-32G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]